The short version of monohydrate fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-05-07 and is reviewed periodically as new material appears.
Several creatine forms are sold, including monohydrate, anhydrous, hydrochloride, nitrate, citrate, and blends. Once dissolved, these forms deliver creatine, but they differ in molar mass, solubility, counterions, and water content. Creatine monohydrate has the largest body of published human data among these forms. Questions remain about whether any alternative form offers meaningful advantages in absorption, tolerability, or tissue uptake under practical conditions. The hydrate form's lower creatine content by mass is a compositional fact, not a statement about effectiveness.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine associates with one molecule of water in the solid lattice. Its molecular formula is C4H11N3O3, and its molar mass is about 149.15 grams per mole. The material appears as a white, odorless powder that dissolves sparingly in water at room temperature. The monohydrate designation distinguishes it from anhydrous creatine, which lacks the bound water and has a lower molar mass. This hydrate is the most common commercial form of creatine used in nutritional and research settings.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H11N3O3 | Often written C4H9N3O2·H2O |
| Molar mass | 149.15 g/mol | Anhydrous creatine is 131.13 g/mol |
| Appearance | White crystalline powder | Odorless, fine or granular |
| Water solubility | About 13 g/L at 25 °C | Low; increases with temperature |
| Common synonyms | Creatine hydrate; N-carbamimidoylsarcosine monohydrate | CAS 6020-87-7 |
Californium was first made at University of California Radiation Laboratory, Berkeley, by physics researchers Stanley Gerald Thompson, Kenneth Street Jr., Albert Ghiorso, and Glenn T. Seaborg, about February 9, 1950. It was the sixth transuranium element to be discovered; the team announced its discovery on March 17, 1950. To produce californium, a microgram-size target of curium-242 (242Cm) was bombarded with 35 MeV alpha particles (4He) in the 60-inch-diameter (1.52 m) cyclotron at Berkeley, which produced californium-245 (245Cf) plus one free neutron (n).
In plants, nitrogen is first assimilated into organic compounds in the form of glutamate, formed from alpha-ketoglutarate and ammonia in the mitochondrion. For other amino acids, plants use transaminases to move the amino group from glutamate to another alpha-keto acid. For example, aspartate aminotransferase converts glutamate and oxaloacetate to alpha-ketoglutarate and aspartate. Other organisms use transaminases for amino acid synthesis, too. Nonstandard amino acids are usually formed through modifications to standard amino acids. For example, homocysteine is formed through the transsulfuration pathway or by the demethylation of methionine via the intermediate metabolite S-adenosylmethionine, while hydroxyproline is made by a post translational modification of proline. Microorganisms and plants synthesize many uncommon amino acids. For example, some microbes make 2-aminoisobutyric acid and lanthionine, which is a sulfide-bridged derivative of alanine. Both of these amino acids are found in peptidic lantibiotics such as alamethicin. However, in plants, 1-aminocyclopropane-1-carboxylic acid is a small disubstituted cyclic amino acid that is an intermediate in the production of the plant hormone ethylene.
Human chorionic gonadotropin is a glycoprotein composed of 237 amino acids with a molecular mass of 36.7 kDa, approximately 14.5kDa αhCG and 22.2kDa βhCG. It is heterodimeric, with an α (alpha) subunit identical to that of luteinizing hormone (LH), follicle-stimulating hormone (FSH), thyroid-stimulating hormone (TSH), and a β (beta) subunit that is unique to hCG. The α (alpha) subunit is 92 amino acids long. The β-subunit of hCG gonadotropin (beta-hCG) contains 145 amino acids, encoded by six highly homologous genes that are arranged in tandem and inverted pairs on chromosome 19q13.3 - CGB (1, 2, 3, 5, 7, 8). It is known that CGB7 has a sequence slightly different from that of the others. The two subunits create a small hydrophobic core surrounded by a high surface area-to-volume ratio: 2.8 times that of a sphere. The vast majority of the outer amino acids are hydrophilic. beta-hCG is mostly similar to beta-LH, with the exception of a Carboxy Terminus Peptide (beta-CTP) containing four glycosylated serine residues that is responsible for hCG's longer half-life.
Velmanase alfa, sold under the brand name Lamzede, is a medication used for the treatment of alpha-mannosidosis. Velmanase alfa is a recombinant human lysosomal alpha-mannosidase. The most common adverse reactions include hypersensitivity reactions including anaphylaxis, a severe, potentially life-threatening allergic reaction. Velmanase alfa was approved for medical use in the European Union in March 2018, and in the United States in February 2023. Velmanase alfa is the first enzyme replacement therapy approved in the US for the treatment of the non-central nervous system manifestations of alpha-mannosidosis. The US Food and Drug Administration (FDA) considers it to be a first-in-class medication.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Sources: en.wikipedia.org
Having worked in industry in the pilot plant of Farbwerke Hoechst AG and then on the surface chemistry of organic pigments, he studied for a PhD at Goethe University in gas-liquid chromatography, a method of separating volatile materials for chemical analysis. He applied his knowledge of chemical engineering science to improving the technology, and developed support-coated open tubular (SCOT) columns which were widely used until supplanted by further developments in capillary columns. He continued to be involved in developments in gas-liquid chromatography in his later career. However, it was while at Harvard Medical School and Yale School of Medicine that he appreciated the need for analytical separation of biological compounds which could not be vaporized, and this led to the application of his particular understanding of separation processes to vastly improve the performance of liquid chromatography. Thus was created high performance liquid chromatography or HPLC, a technique which became a major field of study (and in which he remained a leading figure), and continued to publish till shortly before his death. Together with Imre Molnar and Wayne Melander he developed the framework for describing retention mechanisms in reversed phase chromatography (RPLC), employing the framework of the solvophobic theory. As HPLC and RPLC became the preeminent techniques associated with biochemical analysis, many have suggested that Csaba Horvath inexplicably missed inclusion in the ranks of Nobel laureates.
The mandate includes dose assessment for workers who may be exposed to increased radiation exposure and, if necessary, determination of the activity concentration of residues and radioactive substances discharged with the air or waste water.
==== Edwards v. Aguillard ==== Following the McLean ruling, which declared the teaching of "creation science" in public schools to be an unconstitutional establishment of religion, Louisiana's version of the "Equal Time" legislation was put to the test. This time, Wendell Bird was deputized by the state and ran the state's defense of the law. Dean Kenyon was advertised as the creationists' lead expert witness, however the case (which eventually became Edwards v. Aguillard when it reached the Supreme Court) was decided by summary judgment, and so never went to a full trial. Nevertheless, in written briefs and in his oral arguments, Bird relied heavily on an expert witness affidavit written by Kenyon. This affidavit is online at the TalkOrigins website. It was entered into evidence in the Kitzmiller case as evidence that Kenyon was explicitly defending "creation science"—and advocating that it be given equal time in public schools and textbooks as the "only" alternative to evolution—while at the same time working on a public school textbook, which eventually became the first "intelligent design" book, Of Pandas and People. In 1987, in Edwards v. Aguillard the Supreme Court heard a case concerning a Louisiana Law that required "creation science" be taught on an equal basis with evolution in public schools. Anti-creationists argued that this was illegal on the basis that it violated the Establishment Clause of the US Constitution. Kenyon issued an affidavit in that case, stating his support for creationism, and defining it thus:
== History of ship refrigeration == In 1869, reefers were shipping beef carcasses frozen in a salt-ice mixture from Indianola, Texas, to New Orleans, Louisiana, to be served in hospitals, hotels, and restaurants. In 1874, shipping of frozen beef from America to London had already begun, which developed into an annual tonnage of around 10,000 short tons (8,900 long tons; 9,100 t). The insulated cargo space was cooled by ice, which was loaded on departure. The success of this method was limited by insulation, loading techniques, ice block size, distance and climate. The first attempt to ship refrigerated meat across the Pacific was made when the Northam sailed from Australia to the UK in 1876. The refrigeration machinery broke down en route and the cargo was lost. In the same 1876, French inventor Charles Tellier bought the ex-Elder-Dempster a 690 tons cargo ship Eboe and fitted a Methyl-ether refrigerating plant of his design. The ship was renamed Le Frigorifique and successfully imported a cargo of refrigerated meat from Argentina. However the machinery could be improved and in 1877 another refrigerated ship called Paraguay with a refrigerating plant improved by Ferdinand Carré was put into service on the South American run. Paraguay completed the first successful travel with its shipment of 5500 frozen muttons from Argentina arriving to France in excellent condition despite a collision that delayed the delivery for several months, thus proving the concept of refrigerated ships, if not the economics.
Sources: en.wikipedia.org
== Education == Jennette received his Bachelor of Science in Zoology from the University of North Carolina at Chapel Hill in 1969 and received his M.D. from the UNC School of Medicine in 1973. From 1973 to 1977 he completed anatomic and clinical pathology residency training at UNC, as well as an immunopathology research fellowship at Scripps Clinic and Research Foundation in La Jolla, California.
== Reactivity == The high acidity of the imido N-H is the result of the pair of flanking electron-withdrawing carbonyl groups. Both sodium phthalimide and potassium phthalimide are well known. The latter can be made by reaction of phthalimide with potassium carbonate or potassium hydroxide.. The potassium salt is used in the Gabriel synthesis of primary amines.
Compared with other modes of transport such as aviation and rail, however, driverless technologies for road transport have lagged behind due to road environments being more complex than separated spaces for rail and air transport.
Sources: en.wikipedia.org
It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.
Yes, endogenous synthesis occurs mainly in the liver, kidney, and pancreas. Meat and fish also contribute creatine to the diet.
Other forms contain creatine paired with different counterions or lacking water, so their mass and solubility differ. After dissolution, creatine itself is the shared active molecule.
It is a solid form of creatine that contains one water molecule per creatine molecule in the crystal lattice. The hydrate water is part of the crystal structure rather than loose moisture. The term is often used for the common crystalline powder grade.