bench-notes.peptides9002.com › Topic › Stability, Storage, And Measurement — Explained

Stability, Storage, And Measurement — Explained

By Editorial Desk · published 2026-04-05 · last reviewed 2026-05-06 · Topic

Everything below concerns HPLC-UV. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.

Updated 2026-05-06. Numbers and descriptions here follow the published literature rather than marketing material.

Stability, Storage, and Measurement

Recommended storage usually involves a sealed container kept at room temperature, away from direct sunlight and moisture. High humidity can cause caking, which changes flow properties and may complicate accurate weighing. Repeated opening of containers exposes the powder to air and moisture, so smaller aliquots can reduce handling effects. Storage temperature ranges are not absolute requirements; they reflect conditions that slow degradation and preserve consistent physical characteristics. Clean, dry tools help prevent contamination during sampling.

Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.

Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.

Identity, Natural Role, and Forms

Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.

Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.

Creatine-monohydrate at a glance

PropertyValueNotes
Typical storage temperature15–25 °CCool, dry, sealed conditions slow conversion to creatinine.
Moisture sensitivityModerateAbsorbs water from humid air, which can cause caking.
Primary purity methodHPLC-UVSeparates creatine from creatinine and related impurities.
Moisture methodKarl Fischer titrationMeasures water content; loss on drying is an alternative.
Degradation productCreatinineForms by dehydration, especially in solution or humid heat.

Reference notes

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

KIAA0232 is a nuclear phosphoserine protein which in humans is encoded by the KIAA0232 gene. KIAA0232 is located at 4p16.1 neighboring TBC1 domain family member 14 and an uncharacterized locus. It has 10 exons which comprise its 4 known transcript variants. KIAA0232 is expressed fairly ubiquitously, but particularly highly in the brain relative to other tissues according to GEO normal tissue expression profiling. Other notable areas of high expression identified by EST profiling include nerves, umbilical cord, and parathyroid. There are no known paralogs of KIAA0232. KIAA0232 is conserved in most animals, including mammals, reptiles, birds, amphibians, insects, and as far back as Trichnella spiralis, a species of nematode. It is not found in fungi, plants, or prokaryotes. The KIAA0232 protein is 1395 amino acids in length with a molecular weight of 154.8kDa. It has higher than average frequencies of serine and glutamic acid residues as well as several multi-serine runs that are evolutionarily conserved. It has an isoelectric point of 4.52. KIAA0232 is largely composed of DUF4603.

3-M syndrome or 3M3 is a rare hereditary disorder characterized by severe growth retardation, facial dysmorphia, and skeletal abnormalities. The name 3-M is derived from the initials of the three researchers who first identified it: Miller, McKusick, and Malvaux; they reported their findings in the medical literature in 1972. Mutations in any one of the following three genes: CUL7, OBSL1, and CCDC8 are responsible for the occurrence of this disorder. It is inherited through an autosomal recessive pattern and considered very rare, so far less than 100 cases worldwide have been identified. Diagnosis is based on the presence of clinical features. Genetic testing can confirm the diagnosis and identify the specific gene involved. Treatment is aimed at addressing the growth and skeletal problems and may include surgical bone lengthening, adaptive aids, and physical therapy. An endocrinologist may assist with growth hormone replacement and appropriate evaluations during puberty.

Although it is a relatively immature area of research, it appears that heterotrimeric G-proteins may also take part in non-GPCR signaling. There is evidence for roles as signal transducers in nearly all other types of receptor-mediated signaling, including integrins, receptor tyrosine kinases (RTKs), cytokine receptors (JAK/STATs), as well as modulation of various other "accessory" proteins such as GEFs, guanine-nucleotide dissociation inhibitors (GDIs) and protein phosphatases. There may even be specific proteins of these classes whose primary function is as part of GPCR-independent pathways, termed activators of G-protein signalling (AGS). Both the ubiquity of these interactions and the importance of Gα vs. Gβγ subunits to these processes are still unclear. There are two principal signal transduction pathways involving the G protein-linked receptors: the cAMP signal pathway and the phosphatidylinositol signal pathway.

Tbr1, along with Pax6 and Tbr2, has a role in glutamatergic projection neuron differentiation. Glutamatergic neurons make and release in an activity-dependent manner the excitatory neurotransmitter glutamate as opposed to the inhibitory neurotransmitter GABA. The transition from radial glial cells to postmitotic projection neurons occurs in three steps, each associated with one of the aforementioned transcription factors. The first starts out with the expression of Pax6 in radial glial cells found primarily at the ventricular surface. In the next step, Pax6 is downregulated and Tbr2 is expressed as the cell differentiates into an intermediate progenitor cell. Likewise, in the final step, Tbr2 is extremely downregulated to undetectable levels as Tbr1 signals the transition into a postmitotic projection neuron.

Sources: en.wikipedia.org

Related pages on this site

Notes from published material

After earning his doctorate in biochemistry, Lehninger held various faculty positions at the University of Wisconsin–Madison and the University of Chicago. In 1952, he went to the Johns Hopkins School of Medicine, assuming the title of DeLamar Professor of the Department of Biological Chemistry. He served in this position until 1978, when he was appointed to the role of University Professor of Medical Sciences. He held this title until his death in 1986. 1948 – Paul-Lewis Award in Enzyme Chemistry 1951 – Guggenheim Fellowship 1956 – Elected to the National Academy of Sciences 1959 – Elected to the American Academy of Arts and Sciences 1969 – Remsen Award of the American Chemical Society 1970 – American Philosophical Society 1986 – Passano Foundation Award Forthcoming in New Dictionary of Scientific Biography

Activated protein C–protein C inhibitor (APC-PCI) is a complex of activated protein C (APC) and protein C inhibitor (PCI). It has been measured in coagulation testing to evaluate coagulation, thrombosis, and other cardiovascular complications. It is a marker of thrombin generation and indicates hypercoagulability or presence of thrombosis. Activated Protein C is a vitamin K-dependent serine protease that cleaves and inactivates Factor Va and Factor VIIIa, thus acting as an anticoagulant. Protein C Inhibitor is a 54-kilodalton glycoprotein of the serpin superfamily. Like other serpins, upon cleavage by PC, PCI undergoes a dramatic conformational rearrangement resulting in a stable covalent bond between the two proteins. The resulting PC-PCI protein dimer lacks enzyme activity and is permanently inactivated, an example of suicide inhibition. Formation of this complex is one of the major means of regulation of protein C activity, so that pro-coagulation and anticoagulant activities are kept in balance.

11-Bromodecanoic acid is mixed at 30 °C with a large excess of 40% aqueous ammonia solution. When the reaction is complete, water is added and the mixture is heated to 100 °C to remove the excess ammonia. The acid can be recrystallized from water. For further purification, the hydrochloride of 11-aminoundecanoic acid, which is available by acidification with hydrochloric acid, can be recrystallized from a methanol/ethyl acetate mixture. By acylation of 11-aminoundecanoic acid with chloroacetyl chloride, chloroacetylamino-11-undecanoic acid can be produced, which acts as a fungicide and insecticide. N-acyl derivatives of 11-aminoundecanoic acid in the form of oligomeric amides have remarkable properties as gelling agents for water and organic solvents. By far the most important application of 11-aminoundecanoic acid is its use as a monomer for polyamide 11 (also: nylon-11). Wallace Carothers, the inventor of polyamide (nylon 66), is said to have polymerized 11-aminoundecanoic acid as early as 1931.

Lawsuits against Merck & Co. regarding the marketing and use of Vioxx The landmark whistleblower case involving Neurontin (gabapentin) and off-label marketing: United States of America ex rel. David Franklin vs. Parke-Davis, Division of Warner-Lambert/Pfizer Investigations into conflict of interest and academic institutions by the US Senate Finance Committee, headed by Charles Grassley (R-Iowa) Investigations into the marketing of Vioxx to physicians by the United States House Committee on Oversight and Government Reform, headed by Henry A. Waxman Antitrust litigation involving Abbott Labs and their HIV/AIDS drug Norvir Lawsuits against Wyeth for the unethical promotion of the hormone replacement drug Premarin to women. Wyeth paid medical ghostwriters to author journal articles about the drug.

Tripartite motif-containing 24 (TRIM24) also known as transcriptional intermediary factor 1α (TIF1α) is a protein that, in humans, is encoded by the TRIM24 gene. The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains – a RING, a B-box type 1 and a B-box type 2 – and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. TRIM24 has been shown to interact with Mineralocorticoid receptor, TRIM33, Estrogen receptor alpha and Retinoid X receptor alpha. Transcription coregulator

Sources: en.wikipedia.org

Further detail

Elimination of protruding knobs and controls in passenger compartment Additional padding on the instrument panel and other interior surfaces Mounting points for front outboard shoulder belts Four-way hazard flashers A uniform P-R-N-D-L gear sequence for automatic transmission gear selectors Dual-circuit brake hydraulic systems In 1968, the precursor agency to the US National Highway Traffic Safety Administration's first Federal Motor Vehicle Safety Standards took effect. These required shoulder belts for left and right front-seat vehicle occupants, side marker lights, collapsible steering columns, and other safety features. 1969 saw the addition of head restraints for front outboard passengers, addressing the problem of whiplash in rear-end collisions. These safety requirements did not apply to vehicles classified as "commercial," such as light-duty pickup trucks. Thus, manufacturers did not always include such hardware in these vehicles, even though many did passenger-car duty. Volvo developed the first rear-facing child seat in 1964 and introduced its own booster seat in 1978.

Aldo-keto reductase family 1 (AKR1) is a family of aldo-keto reductase enzymes that is involved in steroid metabolism. It includes the AKR1C and AKR1D subgroups, which respectively consist of AKR1C1–AKR1C4 and AKR1D1. Together with short-chain dehydrogenase/reductases (SDRs), these enzymes catalyze oxidoreductions, act on the C3, C5, C11, C17 and C20 positions of steroids, and function as 3α-HSDTooltip 3α-Hydroxysteroid dehydrogenases, 3β-HSDsTooltip 3β-Hydroxysteroid dehydrogenases, 5β-reductases, 11β-HSDsTooltip 11β-Hydroxysteroid dehydrogenases, 17β-HSDsTooltip 17β-hydroxysteroid dehydrogenases, and 20α-HSDsTooltip 20α-Hydroxysteroid dehydrogenases, respectively. The AKR1C enzymes act as 3-, 17- and 20-ketosteroid reductases, while AKR1D1 acts as the sole 5β-reductase in humans. AKR1A1; AKR1B1; AKR1B10; AKR1C1; AKR1C2; AKR1C3; AKR1C4; AKR1D1; Others Steroidogenic enzyme

CCL7 is expressed in many types of cells, including stromal cells, keratinocytes, airway smooth muscle cells, parenchymal cells, fibroblasts and leukocytes and also in tumor cells. CCL7 mainly acts as a chemoattractant for several leukocytes, including monocytes, eosinophils, basophils, dendritic cells (DCs), neutrophils, NK cells and activated T lymphocytes. Thus, chemotactic factor CCL7 recruits leukocytes to infected tissues to mediate the immune response. Furthermore, CCL7 has an influence to diapedesis and extravasation of leukocytes. The positive effect of CCL7 is mainly observed in monocyte mobilization from bone marrow to blood circulation and in the recruitment of monocytes to sites of inflammation. It was also reported, that CCL7 can also induce neutrophil migration to the inflammatory site by increasing intracellular Ca2+ flux, which is more typical for the CXC chemokine family members. The speed of immune responses varies depending on the type of the cells. In epithelial cells, fibroblasts, and endothelial cells the response is immediate after the stimulation by proinflammatory cytokines as IL-1β and TNFα. In T lymphocytes the expression of CCL7 occurs after 3–5 days after the stimulation. CCL7 has been shown to interact with MMP2 by binding CCR2 receptor.

39. Izv Akad Nauk Ser Biol. 2001 Sep-Oct;(5):517-21. [Rhythm of protein synthesis in cultures of hepatocytes from rats of different ages. Norm and effect of the peptide livagen]. [Article in Russian] Brodskiĭ VIa, Khavinson VKh, Zolotarev IuA, Nechaeva NV, Malinin VV, Novikova TE, Gvazava IG, Fateeva VI. The circumhoralian rhythm of protein synthesis was determined in a monolayer culture of hepatocytes from rats at the age of 1 to 24 months and weighing from 45 to 480 g, respectively. The peptide lyvagen (Lys-Glu-Asp-Ala) obtained by directed chemical synthesis on the basis of amino acid analysis of the liver polypeptide preparations increased the level of protein synthesis in the hepatocytes from rats of different ages; the highest effect was observed in the cells of old animals. In old rats, lyvagen increased the amplitude of protein synthesis fluctuations. The peptide epitalon (Ala-Glu-Asp-Gly) constructed on the basis of analysis of the epiphysis peptides did not change the intensity of protein synthesis in the cultured hepatocytes.

Sources: en.wikipedia.org

Frequently asked questions

Does creatine monohydrate expire?

Solid product can remain within specification for years when stored dry and sealed, but expiration dates reflect manufacturer testing and regulatory conventions. Moisture and heat increase conversion to creatinine, so storage conditions matter more than the printed date alone. Degradation is gradual and can be monitored by purity testing.

How is purity measured?

Purity is typically evaluated by chromatographic separation with ultraviolet detection, sometimes supported by spectroscopic identity tests. Moisture and creatinine content are common quality parameters. Results depend on the analytical method, sample preparation, and specification limits.

Why does creatine monohydrate clump?

Clumping occurs when powder absorbs moisture, causing particles to stick together. Humidity, temperature changes, and repeated container opening promote this effect. Clumps do not necessarily indicate chemical degradation, but they can affect weighing and mixing.

What is the difference between creatine and creatine monohydrate?

Creatine is the base compound, while creatine monohydrate includes one water molecule per creatine molecule in its crystal structure. The monohydrate form is common in supplements and analytical standards. The body uses creatine itself after the water is removed or dissociated.

Network